PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_122121g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family HD-ZIP
Protein Properties Length: 725aa    MW: 80469 Da    PI: 7.0592
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_122121g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.19.9e-21116171156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++e+e++F+++++p++++r++L++kl+L  rq+k+WFqNrR+++k
  MA_122121g0010 116 KKPYHRHTPQQIQEMETFFKECPHPDEKQRQQLSRKLQLAPRQIKFWFQNRRTQMK 171
                     78999************************************************998 PP

2START1854.1e-583145372206
                     HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     la + ++el ++a+++ p W +s+     e +n+de+ + f+++ +     +++ea r  g v+m++ +lve+++d + ++ e+++    +a+tl
  MA_122121g0010 314 LAFTSMNELATMAQVDLPIWISSPhdgikETLNYDEYFRHFPKGIGpkplgYKTEANRNAGTVIMNSINLVEIFMDAN-RYAEMFPsiisRATTL 407
                     67899**************************************999********************************.99999999999***** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vis+g      g+ qlm++elq+lsp vp R+f+f+R+++q+  g w++vdvS ds   +p ++s+v ++++pSg++i++++n  s+vtw+eh+
  MA_122121g0010 408 DVISNGaggtrnGEMQLMYMELQVLSPFVPtREFYFLRFCKQHAPGLWAVVDVSADSLMGNP-NPSSVNCRRRPSGCIIQDMPNACSNVTWIEHI 501
                     **************************************************************.8******************************* PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++ +  +h+l+r+lv+sg+a+g  +w++ lqrqce+
  MA_122121g0010 502 EYADLGVHNLYRPLVSSGMAFGSHRWLSNLQRQCER 537
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-20103174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-21103167IPR009057Homeodomain-like
PROSITE profilePS5007117.281113173IPR001356Homeobox domain
SMARTSM003893.5E-18115177IPR001356Homeobox domain
PfamPF000462.9E-18116171IPR001356Homeobox domain
CDDcd000864.49E-19116174No hitNo description
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084837.566304540IPR002913START domain
SuperFamilySSF559611.2E-32307538No hitNo description
SMARTSM002342.2E-47313537IPR002913START domain
CDDcd088755.40E-115314536No hitNo description
PfamPF018526.3E-49314537IPR002913START domain
Gene3DG3DSA:3.30.530.205.7E-5419535IPR023393START-like domain
SuperFamilySSF559616.66E-9556645No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MTFGFGSLAM GAAAAVNKIS SNKRPFSGMS SNDISYSAMT SAPSQTPNGD MNIYSSTPKL  60
ALTLTSGLDS KGEMIRSSGE PGKIKVDEEY ESRSGSDNVD GNGSADDQDD NQPQRKKPYH  120
RHTPQQIQEM ETFFKECPHP DEKQRQQLSR KLQLAPRQIK FWFQNRRTQM KAQQERHENA  180
ALRDENEKLR MENLSIREAM TTCYNCGGSV MRTDIPSEEQ HLLLENARLK EELGRVSAIT  240
GKFSGRPFPQ MASHSPMHNA SLSMTAVSAG VHNLDSLHST INPTSDFLDG LSAVDVAGRA  300
GSPSGIDKTS AARLAFTSMN ELATMAQVDL PIWISSPHDG IKETLNYDEY FRHFPKGIGP  360
KPLGYKTEAN RNAGTVIMNS INLVEIFMDA NRYAEMFPSI ISRATTLDVI SNGAGGTRNG  420
EMQLMYMELQ VLSPFVPTRE FYFLRFCKQH APGLWAVVDV SADSLMGNPN PSSVNCRRRP  480
SGCIIQDMPN ACSNVTWIEH IEYADLGVHN LYRPLVSSGM AFGSHRWLSN LQRQCERLAV  540
VMDVNADTTV FPDPRGRHGL LKLAQRMTSD FCISLSASIV NNWTTLSGNG DEDIRVSTRK  600
SIENHELPGR VVLCAATSIW LPVTPQKLFD FLRDQRHRSQ WDMLSTDDSN REIVSIVKGQ  660
RSEEHTMLSE TGGSSNSMHK GGSILIVAFQ LLLPDMTTPR PAMDEVKTVQ TLISYTVQKI  720
KSAVI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083470.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLA0A0C9QQ050.0A0A0C9QQ05_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_14231_3459 transcribed RNA sequence
STRINGPP1S173_90V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein